PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009624591.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 237aa    MW: 27598.7 Da    PI: 6.5215
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009624591.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.68e-15956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT++Ed++lv +vk++G ++W+  a+   ++Rt+k+c++rw +yl
   XP_009624591.1  9 KGPWTEQEDLQLVFYVKMFGDRRWDFLAKVSDLKRTGKSCRLRWVNYL 56
                     79********************************************97 PP

2Myb_DNA-binding55.81.1e-1762107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E+ l ++++ ++G++ W++Ia +++ gRt++++k++w++++
   XP_009624591.1  62 RGKMTPQEEHLVLQLHSKYGNR-WSKIAGKLP-GRTDNEIKNYWRTHM 107
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.69456IPR017930Myb domain
SMARTSM007177.2E-12858IPR001005SANT/Myb domain
SuperFamilySSF466897.11E-298103IPR009057Homeodomain-like
PfamPF002493.1E-13956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-201063IPR009057Homeodomain-like
CDDcd001671.42E-81156No hitNo description
PROSITE profilePS5129426.95957111IPR017930Myb domain
SMARTSM007175.4E-1661109IPR001005SANT/Myb domain
PfamPF002492.9E-1662106IPR001005SANT/Myb domain
CDDcd001671.56E-1064107No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2464110IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MVQEEITRKG PWTEQEDLQL VFYVKMFGDR RWDFLAKVSD LKRTGKSCRL RWVNYLNPAL  60
KRGKMTPQEE HLVLQLHSKY GNRWSKIAGK LPGRTDNEIK NYWRTHMRKQ AQDERNKNKA  120
SISPSSSFSN SSSSSANSPT VDSTPDNEQN ERNSNDGLEH LQLAAGENKV HDHESGEKNM  180
MVYSLDEIWK DVESSQDTDQ TMNKLPVMAS PLWDYCPDSL WMTDYYYDNQ DISFFKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-2991114105MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-2991114105C-Myb DNA-Binding Domain
1msf_C7e-2991114105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0130445e-38BT013044.1 Lycopersicon esculentum clone 114294R, mRNA sequence.
GenBankHG9754455e-38HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755185e-38HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009624591.11e-180PREDICTED: transcription factor MYB48-like
SwissprotQ9LX824e-70MYB48_ARATH; Transcription factor MYB48
TrEMBLK4DB183e-90K4DB18_SOLLC; Uncharacterized protein
TrEMBLM1B9E23e-90M1B9E2_SOLTU; Uncharacterized protein
STRINGSolyc11g073120.1.18e-90(Solanum lycopersicum)
STRINGPGSC0003DMT4000401498e-90(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.15e-69myb domain protein 48